ERAS antibody (Middle Region)
-
- Target See all ERAS Antibodies
- ERAS (ES cell expressed Ras (ERAS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERAS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERAS antibody was raised against the middle region of ERAS
- Purification
- Affinity purified
- Immunogen
- ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF
- Top Product
- Discover our top product ERAS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERAS Blocking Peptide, catalog no. 33R-1453, is also available for use as a blocking control in assays to test for specificity of this ERAS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERAS (ES cell expressed Ras (ERAS))
- Alternative Name
- ERAS (ERAS Products)
- Synonyms
- HRAS2 antibody, HRASP antibody, HRasp antibody, Ha-Ras2 antibody, ecat5 antibody, ES cell expressed Ras antibody, ES cell-expressed Ras antibody, ERAS antibody, Eras antibody
- Background
- Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.
- Molecular Weight
- 25 kDa (MW of target protein)
-