C4B antibody

Catalog No. ABIN634315

Product Details anti-C4B Antibody

Target: C4B (C4b) (Complement Component C4b (C4b))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4B

Target: C4B (C4b) (Complement Component C4b (C4b))

Alternative Name: Complement C4b (C4b Products)

Synonyms: C4B1 antibody, C4B12 antibody, C4B2 antibody, C4B3 antibody, C4B5 antibody, C4BD antibody, C4B_2 antibody, C4F antibody, CH antibody, CO4 antibody, CPAMD3 antibody, C4 antibody, C4A2 antibody, C4A3 antibody, C4A4 antibody, C4A6 antibody, C4AD antibody, C4S antibody, CPAMD2 antibody, RG antibody, wu:fi14a03 antibody, C4B antibody, DKFZP469I0332 antibody, Slp antibody, Ss antibody, C4-2 antibody, C4l antibody, complement C4B (Chido blood group) antibody, complement C4A (Rodgers blood group) antibody, complement component 4 antibody, complement C4-B antibody, complement component 4B (Chido blood group) antibody, complement component 4A (Rodgers blood group) antibody, C4B antibody, C4A antibody, c4 antibody, LOC462577 antibody, C4a antibody, C4b antibody

Background: C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Complement System