SOD2 antibody (N-Term)

Catalog No. ABIN634322

Product Details anti-SOD2 Antibody

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SOD2 antibody was raised against the N terminal of SOD2

Purification: Affinity purified

Immunogen: SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Alternative Name: SOD2 (SOD2 Products)

Synonyms: LOC100101896 antibody, MNSOD antibody, GB14346 antibody, sod2 antibody, MGC88869 antibody, Sod2 antibody, CG8905 antibody, Dmel\\CG8905 antibody, Mito SOD antibody, Mn SOD antibody, Mn-SOD antibody, Mn-SOD2 antibody, MnSOD antibody, MnSODII antibody, Mn[2+]SOD antibody, SOD antibody, SOD-2 antibody, SOD2 antibody, Sod-2 antibody, dSOD2 antibody, mitSOD2 antibody, mnSOD antibody, IPOB antibody, MVCD6 antibody, cb463 antibody, wu:fj33b01 antibody, zgc:73051 antibody, MnSOD antibody, manganese superoxide dismutase antibody, superoxide dismutase 2, mitochondrial antibody, superoxide dismutase 2 antibody, Mn superoxide dismutase antibody, Superoxide dismutase 2 (Mn) antibody, superoxide dismutase 2 L homeolog antibody, BDBG_07234 antibody, LOC100101896 antibody, MNSOD antibody, Sod2 antibody, sod2 antibody, LbMnSOD4 antibody, SOD2 antibody, LOC100282741 antibody, SOD-2 antibody, sod2.L antibody

Background: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling