DGKH antibody (Middle Region)
-
- Target See all DGKH Antibodies
- DGKH (Diacylglycerol Kinase, eta (DGKH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DGKH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DGKH antibody was raised against the middle region of DGKH
- Purification
- Affinity purified
- Immunogen
- DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT
- Top Product
- Discover our top product DGKH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DGKH Blocking Peptide, catalog no. 33R-2623, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DGKH (Diacylglycerol Kinase, eta (DGKH))
- Alternative Name
- DGKH (DGKH Products)
- Synonyms
- DGKeta antibody, 5930402B05Rik antibody, D130015C16 antibody, DGKH antibody, RGD1561955 antibody, si:ch211-93a19.1 antibody, diacylglycerol kinase eta antibody, diacylglycerol kinase, eta antibody, DGKH antibody, Dgkh antibody, LOC100546131 antibody, dgkh antibody
- Background
- DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.
- Molecular Weight
- 135 kDa (MW of target protein)
-