DOCK2 antibody (Middle Region)

Catalog No. ABIN634376

Product Details anti-DOCK2 Antibody

Target: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DOCK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DOCK2 antibody was raised against the middle region of DOCK2

Purification: Affinity purified

Immunogen: DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOCK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DOCK2

Target: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Alternative Name: DOCK2 (DOCK2 Products)

Synonyms: AI662014 antibody, AW122239 antibody, CED-5 antibody, Hch antibody, MBC antibody, dedicator of cytokinesis 2 antibody, dedicator of cyto-kinesis 2 antibody, DOCK2 antibody, dock2 antibody, Dock2 antibody

Background: The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.

Molecular Weight: 212 kDa (MW of target protein)