DGKA antibody (N-Term)

Catalog No. ABIN634379

Product Details anti-DGKA Antibody

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGKA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DGKA antibody was raised against the N terminal of DGKA

Purification: Affinity purified

Immunogen: DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGKA Blocking Peptide, catalog no. 33R-2431, is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGKA

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Alternative Name: DGKA (DGKA Products)

Synonyms: DAGK antibody, DAGK1 antibody, DGK-alpha antibody, 80kDa antibody, AW146112 antibody, Dagk1 antibody, dgka antibody, zgc:136759 antibody, dagk antibody, dagk1 antibody, dgk-alpha antibody, diacylglycerol kinase alpha antibody, diacylglycerol kinase, alpha antibody, diacylglycerol kinase, alpha 80kDa antibody, diacylglycerol kinase, alpha a antibody, diacylglycerol kinase alpha S homeolog antibody, DGKA antibody, Dgka antibody, dgkaa antibody, Tsp_02164 antibody, dgka antibody, dgka.S antibody

Background: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

Molecular Weight: 83 kDa (MW of target protein)