RASGRF1 antibody (N-Term)

Catalog No. ABIN634389

Product Details anti-RASGRF1 Antibody

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASGRF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RASGRF1 antibody was raised against the N terminal of RASGRF1

Purification: Affinity purified

Immunogen: RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASGRF1 Blocking Peptide, catalog no. 33R-7877, is also available for use as a blocking control in assays to test for specificity of this RASGRF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASGRF1

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Alternative Name: RASGRF1 (RASGRF1 Products)

Synonyms: CDC25 antibody, CDC25L antibody, GNRP antibody, GRF1 antibody, GRF55 antibody, H-GRF55 antibody, PP13187 antibody, ras-GRF1 antibody, AI844718 antibody, CDC25Mm antibody, Grf1 antibody, Grfbeta antibody, P190-A antibody, Ras-GRF1 antibody, p190 antibody, p190RhoGEF antibody, cdc25 antibody, rasgrf1 antibody, Ras protein specific guanine nucleotide releasing factor 1 antibody, RAS protein-specific guanine nucleotide-releasing factor 1 antibody, Ras protein specific guanine nucleotide releasing factor 1 S homeolog antibody, si:ch211-234p18.3 antibody, RASGRF1 antibody, Rasgrf1 antibody, rasgrf1.S antibody, si:ch211-234p18.3 antibody, rasgrf1 antibody

Background: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: RTK Signaling, Cell Division Cycle, M Phase