MYD88 antibody
-
- Target See all MYD88 Antibodies
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MYD88 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
- Top Product
- Discover our top product MYD88 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MYD88 Blocking Peptide, catalog no. 33R-10165, is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
- Alternative Name
- MYD88 (MYD88 Products)
- Synonyms
- MYD88D antibody, XMyD88 antibody, myd88d antibody, MGC84928 antibody, CG2078 antibody, DMMYD88 antibody, DmMyD88 antibody, DmMyd88 antibody, Dmel\\CG2078 antibody, EP(2)2535 antibody, Kra antibody, LD20892 antibody, MYD88 antibody, MyD88 antibody, Myd88F antibody, dMyD88 antibody, dMyd88 antibody, kra antibody, myd88 antibody, zgc:103541 antibody, GB12344 antibody, NV10640 antibody, myd88-a antibody, myd88-b antibody, myeloid differentiation primary response 88 antibody, myeloid differentiation primary response 88 S homeolog antibody, myeloid differentiation primary response gene 88 antibody, CG2078 gene product from transcript CG2078-RB antibody, myeloid differentiation primary response protein MyD88-A antibody, myeloid differentiation primary response protein MyD88 antibody, myeloid differentiation factor 88 antibody, myeloid differentiation primary response 88 L homeolog antibody, MYD88 antibody, myd88.S antibody, Myd88 antibody, myd88 antibody, LOC413194 antibody, LOC100118553 antibody, LOC575153 antibody, myd88.L antibody
- Background
- This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, TLR Signaling, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades
-