OAS1 antibody (C-Term)

Catalog No. ABIN634457

Product Details anti-OAS1 Antibody

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OAS1 antibody was raised against the C terminal of OAS1

Purification: Affinity purified

Immunogen: OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAS1 Blocking Peptide, catalog no. 33R-3670, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAS1

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Alternative Name: OAS1 (OAS1 Products)

Synonyms: OAS1 antibody, IFI-4 antibody, OIAS antibody, OIASI antibody, L3 antibody, Pp2a2 antibody, 2',5'-oligoadenylate synthetase 1 antibody, 2'-5'-oligoadenylate synthetase 1 antibody, 2'-5' oligoadenylate synthetase 1A antibody, protein phosphatase 2 catalytic subunit beta antibody, OAS1 antibody, Oas1a antibody, Ppp2cb antibody, Oas1 antibody

Background: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Hepatitis C