OAS1 antibody (N-Term)

Catalog No. ABIN634460

Product Details anti-OAS1 Antibody

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OAS1 antibody was raised against the N terminal of OAS1

Purification: Affinity purified

Immunogen: OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAS1 Blocking Peptide, catalog no. 33R-6228, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAS1

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Alternative Name: OAS1 (OAS1 Products)

Synonyms: OAS1 antibody, IFI-4 antibody, OIAS antibody, OIASI antibody, L3 antibody, Pp2a2 antibody, 2',5'-oligoadenylate synthetase 1 antibody, 2'-5'-oligoadenylate synthetase 1 antibody, 2'-5' oligoadenylate synthetase 1A antibody, protein phosphatase 2 catalytic subunit beta antibody, OAS1 antibody, Oas1a antibody, Ppp2cb antibody, Oas1 antibody

Background: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Hepatitis C