Lipocalin 1 antibody
-
- Target See all Lipocalin 1 (LCN1) Antibodies
- Lipocalin 1 (LCN1)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Lipocalin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
- Top Product
- Discover our top product LCN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Lipocalin 1 Blocking Peptide, catalog no. 33R-4140, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lipocalin 1 (LCN1)
- Alternative Name
- Lipocalin 1 (LCN1 Products)
- Synonyms
- PMFA antibody, TLC antibody, TP antibody, VEGP antibody, VEG antibody, lipocalin 1 antibody, odorant binding protein 2B antibody, lipocalin-1 antibody, LCN1 antibody, OBP2B antibody, Lcn1 antibody, LOC103346758 antibody
- Background
- LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.
- Molecular Weight
- 17 kDa (MW of target protein)
-