STK3 antibody
-
- Target See all STK3 Antibodies
- STK3 (serine/threonine Kinase 3 (STK3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG
- Top Product
- Discover our top product STK3 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STK3 Blocking Peptide, catalog no. 33R-5949, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK3 (serine/threonine Kinase 3 (STK3))
- Alternative Name
- STK3 (STK3 Products)
- Synonyms
- KRS1 antibody, MST2 antibody, 0610042I06Rik antibody, MST antibody, Mst2 antibody, Mst3 antibody, Ste20 antibody, mess1 antibody, mst2 antibody, xstk3 antibody, wu:fc19e11 antibody, zgc:55383 antibody, serine/threonine kinase 3 antibody, serine/threonine kinase 3 S homeolog antibody, serine/threonine kinase 3 (STE20 homolog, yeast) antibody, STK3 antibody, Stk3 antibody, stk3.S antibody, stk3 antibody
- Background
- Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-