ADRB1 antibody (Middle Region)

Catalog No. ABIN634512

Product Details anti-ADRB1 Antibody

Target: ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADRB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADRB1 antibody was raised against the middle region of ADRB1

Purification: Affinity purified

Immunogen: ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADRB1 Blocking Peptide, catalog no. 33R-1826, is also available for use as a blocking control in assays to test for specificity of this ADRB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADRB1

Target: ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))

Alternative Name: ADRB1 (ADRB1 Products)

Synonyms: ADRB1R antibody, B1AR antibody, BETA1AR antibody, RHR antibody, RATB1AR antibody, X-Beta1AR antibody, BAR1 antibody, zgc:194728 antibody, zgc:194731 antibody, ADRB1 antibody, Adrb-1 antibody, beta-AR antibody, adrenoceptor beta 1 antibody, adrenoceptor beta 1 L homeolog antibody, adrenergic, beta-1-, receptor antibody, adrenergic receptor, beta 1 antibody, ADRB1 antibody, Adrb1 antibody, adrb1.L antibody, adrb1 antibody

Background: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Cellular Glucan Metabolic Process, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Brown Fat Cell Differentiation