ADRB1 antibody (Middle Region)
-
- Target See all ADRB1 Antibodies
- ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADRB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADRB1 antibody was raised against the middle region of ADRB1
- Purification
- Affinity purified
- Immunogen
- ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
- Top Product
- Discover our top product ADRB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADRB1 Blocking Peptide, catalog no. 33R-1826, is also available for use as a blocking control in assays to test for specificity of this ADRB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADRB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))
- Alternative Name
- ADRB1 (ADRB1 Products)
- Synonyms
- ADRB1R antibody, B1AR antibody, BETA1AR antibody, RHR antibody, RATB1AR antibody, X-Beta1AR antibody, BAR1 antibody, zgc:194728 antibody, zgc:194731 antibody, ADRB1 antibody, Adrb-1 antibody, beta-AR antibody, adrenoceptor beta 1 antibody, adrenoceptor beta 1 L homeolog antibody, adrenergic, beta-1-, receptor antibody, adrenergic receptor, beta 1 antibody, ADRB1 antibody, Adrb1 antibody, adrb1.L antibody, adrb1 antibody
- Background
- The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Cellular Glucan Metabolic Process, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Brown Fat Cell Differentiation
-