RHOT1 antibody (Middle Region)
-
- Target See all RHOT1 Antibodies
- RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHOT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHOT1 antibody was raised against the middle region of RHOT1
- Purification
- Affinity purified
- Immunogen
- RHOT1 antibody was raised using the middle region of RHOT1 corresponding to a region with amino acids ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR
- Top Product
- Discover our top product RHOT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHOT1 Blocking Peptide, catalog no. 33R-1502, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))
- Alternative Name
- RHOT1 (RHOT1 Products)
- Synonyms
- rhot1 antibody, zgc:55581 antibody, zgc:77063 antibody, wu:fd14e11 antibody, wu:fi14a05 antibody, arht2 antibody, miro-2 antibody, rasl antibody, ARHT1 antibody, MIRO-1 antibody, MIRO1 antibody, 2210403N23Rik antibody, AA415293 antibody, AF244542 antibody, AI834919 antibody, Arht1 antibody, C430039G08Rik antibody, Miro1 antibody, miro1 antibody, si:dkeyp-97g3.6 antibody, ras homolog family member T1a antibody, ras homolog family member T2 antibody, ras homolog family member T1 antibody, ras homolog family member T1 L homeolog antibody, rhot1a antibody, rhot2 antibody, RHOT1 antibody, rhot1 antibody, rhot1.L antibody, Rhot1 antibody, rhot1b antibody
- Background
- Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
- Molecular Weight
- 71 kDa (MW of target protein)
-