GLP2R antibody (N-Term)

Catalog No. ABIN634532

Product Details anti-GLP2R Antibody

Target: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLP2R antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLP2 R antibody was raised against the N terminal of GLP2

Purification: Affinity purified

Immunogen: GLP2 R antibody was raised using the N terminal of GLP2 corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLP2R Blocking Peptide, catalog no. 33R-4510, is also available for use as a blocking control in assays to test for specificity of this GLP2R antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLP2R

Target: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Alternative Name: GLP2R (GLP2R Products)

Synonyms: 9530092J08Rik antibody, GLP-2 antibody, glucagon like peptide 2 receptor antibody, glucagon-like peptide 2 receptor antibody, GLP2R antibody, Glp2r antibody

Background: The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Feeding Behaviour