ATP2C1 antibody (C-Term)

Catalog No. ABIN634534

Product Details anti-ATP2C1 Antibody

Target: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2C1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP2 C1 antibody was raised against the C terminal of ATP2 1

Purification: Affinity purified

Immunogen: ATP2 C1 antibody was raised using the C terminal of ATP2 1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP2C1 Blocking Peptide, catalog no. 33R-9151, is also available for use as a blocking control in assays to test for specificity of this ATP2C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP2C1

Target: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Alternative Name: ATP2C1 (ATP2C1 Products)

Synonyms: ATP2C1 antibody, ATP2C1A antibody, BCPM antibody, HHD antibody, PMR1 antibody, SPCA1 antibody, hSPCA1 antibody, Spca1 antibody, si:dkey-11p23.6 antibody, SPCA antibody, 1700121J11Rik antibody, AW061228 antibody, D930003G21Rik antibody, pmr1 antibody, ATPase secretory pathway Ca2+ transporting 1 antibody, ATPase, Ca++ transporting, type 2C, member 1 antibody, ATPase, Ca++-sequestering antibody, ATP2C1 antibody, atp2c1 antibody, Atp2c1 antibody

Background: ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process