BAFF antibody
-
- Target See all BAFF (TNFSF13B) Antibodies
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BAFF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TNFSF13 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
- Top Product
- Discover our top product TNFSF13B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNFSF13B Blocking Peptide, catalog no. 33R-1363, is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
- Alternative Name
- TNFSF13B (TNFSF13B Products)
- Synonyms
- BAFF antibody, BLYS antibody, CD257 antibody, DTL antibody, TALL-1 antibody, TALL1 antibody, THANK antibody, TNFSF20 antibody, ZTNF4 antibody, BAFF-R antibody, BAFFR antibody, BROMIX antibody, CD268 antibody, CVID4 antibody, prolixin antibody, TNFSF13B antibody, RGD1561519 antibody, RGD1560810 antibody, BLyS antibody, D8Ertd387e antibody, zTNF4 antibody, 2010006P15Rik antibody, Baffr antibody, Bcmd antibody, Bcmd-1 antibody, Bcmd1 antibody, Lvis22 antibody, zgc:172115 antibody, TNF superfamily member 13b antibody, TNF receptor superfamily member 13C antibody, tumor necrosis factor (ligand) superfamily, member 13b antibody, tumor necrosis factor receptor superfamily, member 13c antibody, tumor necrosis factor superfamily member 13b antibody, TNFSF13B antibody, TNFRSF13C antibody, Tnfsf13b antibody, Tnfrsf13c antibody, tnfsf13b antibody
- Background
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, Production of Molecular Mediator of Immune Response
-