CXCL16 antibody
-
- Target See all CXCL16 Antibodies
- CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CXCL16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV
- Top Product
- Discover our top product CXCL16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CXCL16 Blocking Peptide, catalog no. 33R-8984, is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXCL16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))
- Alternative Name
- CXCL16 (CXCL16 Products)
- Synonyms
- CXCL16 antibody, 0910001K24Rik antibody, AV290116 antibody, BB024863 antibody, CXCL16v1 antibody, CXCL16v2 antibody, SR-PSOX antibody, Zmynd15 antibody, b2b498Clo antibody, CXCLG16 antibody, SRPSOX antibody, C-X-C motif chemokine ligand 16 antibody, chemokine (C-X-C motif) ligand 16 antibody, CXCL16 antibody, Cxcl16 antibody
- Background
- CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.
- Molecular Weight
- 29 kDa (MW of target protein)
-