PHLDA2 antibody (Middle Region)
-
- Target See all PHLDA2 Antibodies
- PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHLDA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHLDA2 antibody was raised against the middle region of PHLDA2
- Purification
- Affinity purified
- Immunogen
- PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
- Top Product
- Discover our top product PHLDA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHLDA2 Blocking Peptide, catalog no. 33R-7668, is also available for use as a blocking control in assays to test for specificity of this PHLDA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))
- Alternative Name
- PHLDA2 (PHLDA2 Products)
- Synonyms
- PHLDA2 antibody, ipl antibody, phlda2 antibody, BRW1C antibody, BWR1C antibody, HLDA2 antibody, IPL antibody, TSSC3 antibody, Ipl antibody, Tssc3 antibody, zgc:110459 antibody, pleckstrin homology like domain family A member 2 antibody, Pleckstrin homology-like domain family A member 2 antibody, pleckstrin homology like domain, family A, member 2 antibody, pleckstrin homology-like domain, family A, member 2 antibody, pleckstrin homology-like domain, family A, member 2 L homeolog antibody, PHLDA2 antibody, phla2 antibody, Phlda2 antibody, phlda2.L antibody, phlda2 antibody
- Background
- This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor and rhabdomyosarcoma.
- Molecular Weight
- 17 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process
-