IGSF1 antibody (Middle Region)
-
- Target See all IGSF1 (INHBP) Antibodies
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGSF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGSF1 antibody was raised against the middle region of IGSF1
- Purification
- Affinity purified
- Immunogen
- IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
- Top Product
- Discover our top product INHBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGSF1 Blocking Peptide, catalog no. 33R-9197, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
- Alternative Name
- IGSF1 (INHBP Products)
- Synonyms
- CHTE antibody, IGCD1 antibody, IGDC1 antibody, INHBP antibody, PGSF2 antibody, p120 antibody, 5330413N23 antibody, 5530402E03 antibody, AI747649 antibody, InhBP/p120 antibody, mKIAA0364 antibody, Inhbp antibody, immunoglobulin superfamily member 1 antibody, immunoglobulin superfamily, member 1 antibody, inhibin binding protein antibody, IGSF1 antibody, Igsf1 antibody, LOC443288 antibody
- Background
- Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.
- Molecular Weight
- 27 kDa (MW of target protein)
-