SSX2IP antibody (Middle Region)
-
- Target See all SSX2IP Antibodies
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SSX2IP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SSX2 IP antibody was raised against the middle region of SSX2 P
- Purification
- Affinity purified
- Immunogen
- SSX2 IP antibody was raised using the middle region of SSX2 P corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
- Top Product
- Discover our top product SSX2IP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SSX2IP Blocking Peptide, catalog no. 33R-4706, is also available for use as a blocking control in assays to test for specificity of this SSX2IP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSX0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
- Alternative Name
- SSX2IP (SSX2IP Products)
- Synonyms
- zgc:73314 antibody, MGC83757 antibody, ADIP antibody, LCG antibody, AU014939 antibody, AU042321 antibody, Adip antibody, synovial sarcoma, X breakpoint 2 interacting protein a antibody, synovial sarcoma, X breakpoint 2 interacting protein S homeolog antibody, SSX family member 2 interacting protein antibody, synovial sarcoma, X 2 interacting protein antibody, ssx2ipa antibody, ssx2ip.S antibody, SSX2IP antibody, Ssx2ip antibody
- Background
- SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
- Molecular Weight
- 68 kDa (MW of target protein)
-