Laminin gamma 1 antibody
-
- Target See all Laminin gamma 1 (LAMC1) Antibodies
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Laminin gamma 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ
- Top Product
- Discover our top product LAMC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
- Alternative Name
- Laminin gamma 1 (LAMC1 Products)
- Synonyms
- lamb2 antibody, Lamb2 antibody, B2e antibody, sly antibody, LAMB2 antibody, putative laminin gamma-1 chain antibody, laminin subunit gamma 1 antibody, laminin, gamma 1 antibody, Smp_163810 antibody, lamc1 antibody, Lamc1 antibody, LAMC1 antibody
- Background
- Laminin is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
- Molecular Weight
- 177 kDa (MW of target protein)
-