NEDD9 antibody (Middle Region)

Catalog No. ABIN634649

Product Details anti-NEDD9 Antibody

Target: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEDD9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NEDD9 antibody was raised against the middle region of NEDD9

Purification: Affinity purified

Immunogen: NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEDD9 Blocking Peptide, catalog no. 33R-2070, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEDD9

Target: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Alternative Name: NEDD9 (NEDD9 Products)

Synonyms: NEDD9 antibody, CAS-L antibody, CAS2 antibody, CASL antibody, CASS2 antibody, HEF1 antibody, Cas-L antibody, CasL antibody, E230025G09Rik antibody, neural precursor cell expressed, developmentally down-regulated 9 antibody, neural precursor cell expressed, developmentally down-regulated gene 9 antibody, NEDD9 antibody, Nedd9 antibody

Background: Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

Molecular Weight: 93 kDa (MW of target protein)