LGALS3BP antibody (Middle Region)

Catalog No. ABIN634658

Product Details anti-LGALS3BP Antibody

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS3BP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LGALS3 BP antibody was raised against the middle region of LGALS3 P

Purification: Affinity purified

Immunogen: LGALS3 BP antibody was raised using the middle region of LGALS3 P corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS3BP Blocking Peptide, catalog no. 33R-6776, is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-LGALS3BP antibody (ABIN634658)

Langley, Willeit, Didangelos, Matic, Skroblin, Barallobre-Barreiro, Lengquist, Rungger, Kapustin, Kedenko, Molenaar, Lu, Barwari, Suna, Yin, Iglseder, Paulweber, Willeit, Shalhoub, Pasterkamp, Davies et al.: "Extracellular matrix proteomics identifies molecular signature of symptomatic carotid plaques. ..." in: The Journal of clinical investigation, Vol. 127, Issue 4, pp. 1546-1560, (2017) (PubMed).

Target Details for LGALS3BP

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Alternative Name: LGALS3BP (LGALS3BP Products)

Synonyms: 90K antibody, BTBD17B antibody, MAC-2-BP antibody, TANGO10B antibody, Ppicap antibody, CyCAP antibody, MAC-2BP antibody, Tango10b antibody, lgals3bp antibody, zgc:136780 antibody, MAC2BP antibody, Mac-2 BP antibody, zgc:77059 antibody, galectin 3 binding protein antibody, lectin, galactoside-binding, soluble, 3 binding protein antibody, calcium activated nucleotidase 1 antibody, lectin, galactoside-binding, soluble, 3 binding protein a antibody, lectin, galactoside-binding, soluble, 3 binding protein b antibody, LGALS3BP antibody, Lgals3bp antibody, CANT1 antibody, lgals3bpa antibody, lgals3bpb antibody

Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Molecular Weight: 63 kDa (MW of target protein)