AZGP1 antibody (N-Term)
-
- Target See all AZGP1 Antibodies
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AZGP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AZGP1 antibody was raised against the N terminal of AZGP1
- Purification
- Affinity purified
- Immunogen
- AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
- Top Product
- Discover our top product AZGP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
- Alternative Name
- AZGP1 (AZGP1 Products)
- Synonyms
- Zag antibody, ZA2G antibody, ZAG antibody, ZA2GA antibody, Zna2gp antibody, alpha-2-glycoprotein 1, zinc antibody, alpha-2-glycoprotein 1, zinc-binding antibody, Azgp1 antibody, AZGP1 antibody
- Background
- Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-