AZGP1 antibody (N-Term)

Catalog No. ABIN634659

Product Details anti-AZGP1 Antibody

Target: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AZGP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AZGP1 antibody was raised against the N terminal of AZGP1

Purification: Affinity purified

Immunogen: AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AZGP1

Target: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Alternative Name: AZGP1 (AZGP1 Products)

Synonyms: Zag antibody, ZA2G antibody, ZAG antibody, ZA2GA antibody, Zna2gp antibody, alpha-2-glycoprotein 1, zinc antibody, alpha-2-glycoprotein 1, zinc-binding antibody, Azgp1 antibody, AZGP1 antibody

Background: Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process