ADAM15 antibody (Middle Region)

Catalog No. ABIN634676

Product Details anti-ADAM15 Antibody

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAM15 antibody was raised against the middle region of ADAM15

Purification: Affinity purified

Immunogen: ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM15 Blocking Peptide, catalog no. 33R-7669, is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM15

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Alternative Name: ADAM15 (ADAM15 Products)

Synonyms: ADAM15 antibody, mdc15 antibody, MDC15 antibody, metargidin antibody, tMDCVI antibody, ADAM metallopeptidase domain 15 antibody, ADAM metallopeptidase domain 15 L homeolog antibody, a disintegrin and metallopeptidase domain 15 (metargidin) antibody, ADAM15 antibody, adam15.L antibody, adam15 antibody, Adam15 antibody

Background: ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.

Molecular Weight: 70 kDa (MW of target protein)