ADAM15 antibody (Middle Region)
-
- Target See all ADAM15 Antibodies
- ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAM15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADAM15 antibody was raised against the middle region of ADAM15
- Purification
- Affinity purified
- Immunogen
- ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ
- Top Product
- Discover our top product ADAM15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAM15 Blocking Peptide, catalog no. 33R-7669, is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))
- Alternative Name
- ADAM15 (ADAM15 Products)
- Synonyms
- ADAM15 antibody, mdc15 antibody, MDC15 antibody, metargidin antibody, tMDCVI antibody, ADAM metallopeptidase domain 15 antibody, ADAM metallopeptidase domain 15 L homeolog antibody, a disintegrin and metallopeptidase domain 15 (metargidin) antibody, ADAM15 antibody, adam15.L antibody, adam15 antibody, Adam15 antibody
- Background
- ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.
- Molecular Weight
- 70 kDa (MW of target protein)
-