GJA4 antibody (Middle Region)
-
- Target See all GJA4 Antibodies
- GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJA4 antibody was raised against the middle region of GJA4
- Purification
- Affinity purified
- Immunogen
- GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
- Top Product
- Discover our top product GJA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJA4 Blocking Peptide, catalog no. 33R-7598, is also available for use as a blocking control in assays to test for specificity of this GJA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))
- Alternative Name
- GJA4 (GJA4 Products)
- Synonyms
- AU020209 antibody, AW558810 antibody, Cnx37 antibody, Cx37 antibody, Gja-4 antibody, CXN37 antibody, CX37 antibody, Cx39 antibody, ggCx39 antibody, cx41 antibody, gja4 antibody, gap junction protein alpha 4 antibody, gap junction protein, alpha 4 antibody, gap junction protein, alpha 4, 37kDa antibody, gap junction protein alpha 4 L homeolog antibody, GJA4 antibody, Gja4 antibody, gja4.L antibody
- Background
- GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-