GJA4 antibody (Middle Region)

Catalog No. ABIN634684

Product Details anti-GJA4 Antibody

Target: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJA4 antibody was raised against the middle region of GJA4

Purification: Affinity purified

Immunogen: GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA4 Blocking Peptide, catalog no. 33R-7598, is also available for use as a blocking control in assays to test for specificity of this GJA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJA4

Target: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Alternative Name: GJA4 (GJA4 Products)

Synonyms: AU020209 antibody, AW558810 antibody, Cnx37 antibody, Cx37 antibody, Gja-4 antibody, CXN37 antibody, CX37 antibody, Cx39 antibody, ggCx39 antibody, cx41 antibody, gja4 antibody, gap junction protein alpha 4 antibody, gap junction protein, alpha 4 antibody, gap junction protein, alpha 4, 37kDa antibody, gap junction protein alpha 4 L homeolog antibody, GJA4 antibody, Gja4 antibody, gja4.L antibody

Background: GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization