Ephrin B1 antibody (Middle Region)

Catalog No. ABIN634690

Product Details anti-Ephrin B1 Antibody

Target: Ephrin B1 (EFNB1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ephrin B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ephrin-B1 antibody was raised against the middle region of EFNB1

Purification: Affinity purified

Immunogen: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ephrin-B1 Blocking Peptide, catalog no. 33R-8768, is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ephrin B1

Target: Ephrin B1 (EFNB1)

Alternative Name: Ephrin-B1 (EFNB1 Products)

Synonyms: EFNB1 antibody, LERK2 antibody, Cek5-L antibody, EFL-3 antibody, Elk-L antibody, Epl2 antibody, Eplg2 antibody, LERK-2 antibody, Lerk2 antibody, Stra1 antibody, CFND antibody, CFNS antibody, EFL3 antibody, EPLG2 antibody, cfnd antibody, cfns antibody, efl3 antibody, efnb1-A antibody, ephrinB1 antibody, eplg2 antibody, lerk2 antibody, ephrin B1 antibody, ephrin-B1 antibody, ephrin-B1 L homeolog antibody, EFNB1 antibody, Efnb1 antibody, efnb1 antibody, efnb1.L antibody

Background: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: RTK Signaling