GJC2 antibody (Middle Region)

Catalog No. ABIN634743

Product Details anti-GJC2 Antibody

Target: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJC2 antibody was raised against the middle region of GJC2

Purification: Affinity purified

Immunogen: GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJC2

Target: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Alternative Name: GJC2 (GJC2 Products)

Synonyms: GJA12 antibody, cx47 antibody, gja12 antibody, cx46.6 antibody, pmldar antibody, MGC146420 antibody, B230382L12Rik antibody, Cx47 antibody, Gja12 antibody, CX46.6 antibody, HLD2 antibody, LMPH1C antibody, PMLDAR antibody, SPG44 antibody, gap junction protein gamma 2 antibody, si:dkey-91f15.1 antibody, gap junction protein, gamma 2 antibody, GJC2 antibody, gjc2 antibody, si:dkey-91f15.1 antibody, Gjc2 antibody

Background: GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.

Molecular Weight: 47 kDa (MW of target protein)