Claudin 15 antibody (Middle Region)
-
- Target See all Claudin 15 (CLDN15) Antibodies
- Claudin 15 (CLDN15)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Claudin 15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Claudin 15 antibody was raised against the middle region of CLDN15
- Purification
- Affinity purified
- Immunogen
- Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
- Top Product
- Discover our top product CLDN15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 15 (CLDN15)
- Alternative Name
- Claudin 15 (CLDN15 Products)
- Synonyms
- CLDN15 antibody, cldn15 antibody, cldn15l antibody, zgc:63943 antibody, zgc:136755 antibody, 2210009B08Rik antibody, BB107105 antibody, claudin 15 antibody, claudin 15a antibody, claudin 15b antibody, Cldn15 antibody, CLDN15 antibody, cldn15a antibody, cldn15b antibody
- Background
- CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-