LYVE1 antibody (N-Term)

Catalog No. ABIN634754

Product Details anti-LYVE1 Antibody

Target: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYVE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYVE1 antibody was raised against the N terminal of LYVE1

Purification: Affinity purified

Immunogen: LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-LYVE1 antibody (ABIN634754)

Yücel, Johnston, Ly, Patel, Drake, Gümüş, Fraenkl, Moore, Tobbia, Armstrong, Horvath, Gupta: "Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).

Target Details for LYVE1

Target: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Alternative Name: LYVE1 (LYVE1 Products)

Synonyms: LYVE1 antibody, XLKD1 antibody, CRSBP-1 antibody, HAR antibody, LYVE-1 antibody, 1200012G08Rik antibody, Crsbp-1 antibody, Lyve-1 antibody, Xlkd1 antibody, lymphatic vessel endothelial hyaluronic receptor 1a antibody, lymphatic vessel endothelial hyaluronan receptor 1 antibody, lyve1a antibody, LYVE1 antibody, Lyve1 antibody

Background: LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process