CSHL1 antibody (C-Term)
-
- Target See all CSHL1 Antibodies
- CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSHL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSHL1 antibody was raised against the C terminal of CSHL1
- Purification
- Affinity purified
- Immunogen
- CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV
- Top Product
- Discover our top product CSHL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSHL1 Blocking Peptide, catalog no. 33R-3515, is also available for use as a blocking control in assays to test for specificity of this CSHL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSHL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))
- Alternative Name
- CSHL1 (CSHL1 Products)
- Synonyms
- CSHL1 antibody, PL-D antibody, CS-5 antibody, CSHP1 antibody, CSL antibody, hCS-L antibody, placental lactogen PL-D antibody, chorionic somatomammotropin hormone like 1 antibody, PL-D antibody, CSHL1 antibody
- Background
- CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.
- Molecular Weight
- 20 kDa (MW of target protein)
-