Leptin antibody (N-Term)

Catalog No. ABIN634794

Product Details anti-Leptin Antibody

Target: Leptin (LEP)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Leptin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Leptin antibody was raised against the N terminal of LEP

Purification: Affinity purified

Immunogen: Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Leptin

Target: Leptin (LEP)

Alternative Name: Leptin (LEP Products)

Synonyms: ob antibody, obese antibody, LEPD antibody, OB antibody, OBS antibody, leptin antibody, Lep antibody, LEP antibody, lep antibody

Background: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process