PI16 antibody (Middle Region)
-
- Target See all PI16 Antibodies
- PI16 (Peptidase Inhibitor 16 (PI16))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PI16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PI16 antibody was raised against the middle region of PI16
- Purification
- Affinity purified
- Immunogen
- PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV
- Top Product
- Discover our top product PI16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PI16 Blocking Peptide, catalog no. 33R-8568, is also available for use as a blocking control in assays to test for specificity of this PI16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PI16 (Peptidase Inhibitor 16 (PI16))
- Alternative Name
- PI16 (PI16 Products)
- Synonyms
- CRISP9 antibody, MSMBBP antibody, PSPBP antibody, 1200009H11Rik antibody, Cripi antibody, PI-16 antibody, peptidase inhibitor 16 antibody, Pi16 antibody, Tsp_02917 antibody, PI16 antibody
- Background
- PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.
- Molecular Weight
- 47 kDa (MW of target protein)
-