MMEL1 antibody (Middle Region)
-
- Target See all MMEL1 Antibodies
- MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMEL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MMEL1 antibody was raised against the middle region of MMEL1
- Purification
- Affinity purified
- Immunogen
- MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
- Top Product
- Discover our top product MMEL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMEL1 Blocking Peptide, catalog no. 33R-2809, is also available for use as a blocking control in assays to test for specificity of this MMEL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMEL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))
- Alternative Name
- MMEL1 (MMEL1 Products)
- Synonyms
- MMEL2 antibody, NEP2 antibody, NEPII antibody, NL1 antibody, NL2 antibody, SEP antibody, Mell1 antibody, Nl1 antibody, MMEL1 antibody, membrane metalloendopeptidase like 1 antibody, membrane metallo-endopeptidase-like 1 antibody, MMEL1 antibody, Mmel1 antibody, mmel1 antibody
- Background
- MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.
- Molecular Weight
- 88 kDa (MW of target protein)
-