-
- Target
- Glycoprotein
- Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Glycoprotein Blocking Peptide, catalog no. 33R-1947, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glycoprotein
- Synonyms
- glycoprotein antibody, Glycoprotein antibody, transmembrane glycoprotein G antibody, G antibody, RVFV_sM_gp1 antibody, RABVgp4 antibody
- Target Type
- Viral Protein
- Background
- GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts.
- Molecular Weight
- 62 kDa (MW of target protein)
-
You are here:
