SLC22A14 antibody (N-Term)

Catalog No. ABIN634865

Product Details anti-SLC22A14 Antibody

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC22 A14 antibody was raised against the N terminal of SLC22 14

Purification: Affinity purified

Immunogen: SLC22 A14 antibody was raised using the N terminal of SLC22 14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A14 Blocking Peptide, catalog no. 33R-4005, is also available for use as a blocking control in assays to test for specificity of this SLC22A14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A14

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Alternative Name: SLC22A14 (SLC22A14 Products)

Synonyms: Gm1128 antibody, OCTL2 antibody, OCTL4 antibody, ORCTL4 antibody, solute carrier family 22, member 14 antibody, solute carrier family 22 member 14 antibody, solute carrier family 22 (organic cation transporter), member 14 antibody, Slc22a14 antibody, SLC22A14 antibody

Background: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

Molecular Weight: 67 kDa (MW of target protein)