MT-ND6 antibody
-
- Target See all MT-ND6 Antibodies
- MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MT-ND6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
- Top Product
- Discover our top product MT-ND6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))
- Alternative Name
- ND6 (MT-ND6 Products)
- Synonyms
- MTND6 antibody, NADH6 antibody, mitochondrial NADH-ubiquinone oxidoreductase chain 6 antibody, NADH dehydrogenase, subunit 6 (complex I) antibody, NADH dehydrogenase subunit 6 antibody, NADH dehydrogenasesubunit 6 antibody, mt:ND6 antibody, ND6 antibody, nad6 antibody
- Background
- ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
- Molecular Weight
- 19 kDa (MW of target protein)
-