MT-ND6 antibody

Catalog No. ABIN634876

Product Details anti-MT-ND6 Antibody

Target: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MT-ND6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MT-ND6

Target: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Alternative Name: ND6 (MT-ND6 Products)

Synonyms: MTND6 antibody, NADH6 antibody, mitochondrial NADH-ubiquinone oxidoreductase chain 6 antibody, NADH dehydrogenase, subunit 6 (complex I) antibody, NADH dehydrogenase subunit 6 antibody, NADH dehydrogenasesubunit 6 antibody, mt:ND6 antibody, ND6 antibody, nad6 antibody

Background: ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Molecular Weight: 19 kDa (MW of target protein)