SLC43A1 antibody (Middle Region)
-
- Target See all SLC43A1 Antibodies
- SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC43A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC43 A1 antibody was raised against the middle region of SLC43 1
- Purification
- Affinity purified
- Immunogen
- SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI
- Top Product
- Discover our top product SLC43A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC43A1 Blocking Peptide, catalog no. 33R-1608, is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))
- Alternative Name
- SLC43A1 (SLC43A1 Products)
- Synonyms
- 2610016F07Rik antibody, AA986141 antibody, Lat3 antibody, PB39 antibody, Pov1 antibody, R00504 antibody, LAT3 antibody, POV1 antibody, fi47a12 antibody, lat3a antibody, slc43a1 antibody, wu:fi47a12 antibody, zgc:55850 antibody, wu:fa01a01 antibody, zgc:158383 antibody, solute carrier family 43, member 1 antibody, solute carrier family 43 member 1 antibody, solute carrier family 43 (amino acid system L transporter), member 1a antibody, solute carrier family 43 (amino acid system L transporter), member 1b antibody, solute carrier family 43 member 1 L homeolog antibody, Slc43a1 antibody, SLC43A1 antibody, slc43a1a antibody, slc43a1b antibody, slc43a1.L antibody
- Background
- SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.
- Molecular Weight
- 61 kDa (MW of target protein)
-