FJX1 antibody
-
- Target See all FJX1 Antibodies
- FJX1 (Four Jointed Box 1 (FJX1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FJX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
- Top Product
- Discover our top product FJX1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FJX1 Blocking Peptide, catalog no. 33R-6577, is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FJX1 (Four Jointed Box 1 (FJX1))
- Alternative Name
- FJX1 (FJX1 Products)
- Synonyms
- four jointed box 1 antibody, four jointed box 1 (Drosophila) antibody, FJX1 antibody, Fjx1 antibody
- Background
- FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.
- Molecular Weight
- 48 kDa (MW of target protein)
-