TMEM163 antibody (Middle Region)
-
- Target See all TMEM163 Antibodies
- TMEM163 (Transmembrane Protein 163 (TMEM163))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM163 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM163 antibody was raised against the middle region of TMEM163
- Purification
- Affinity purified
- Immunogen
- TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV
- Top Product
- Discover our top product TMEM163 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM163 Blocking Peptide, catalog no. 33R-1058, is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM163 (Transmembrane Protein 163 (TMEM163))
- Alternative Name
- TMEM163 (TMEM163 Products)
- Synonyms
- si:dkey-57b6.2 antibody, DC29 antibody, SV31 antibody, 2610024A01Rik antibody, RGD1306212 antibody, Sv31 antibody, transmembrane protein 163a antibody, Transmembrane protein 163 antibody, transmembrane protein 163 antibody, transmembrane protein 163 L homeolog antibody, tmem163a antibody, tm163 antibody, TMEM163 antibody, Tmem163 antibody, tmem163.L antibody
- Background
- The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 31 kDa (MW of target protein)
-