ORAI1 antibody (Middle Region)

Catalog No. ABIN634999

Product Details anti-ORAI1 Antibody

Target: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ORAI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ORAI1 antibody was raised against the middle region of ORAI1

Purification: Affinity purified

Immunogen: ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ORAI1 Blocking Peptide, catalog no. 33R-3979, is also available for use as a blocking control in assays to test for specificity of this ORAI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ORAI1

Target: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Alternative Name: ORAI1 (ORAI1 Products)

Synonyms: CRACM1 antibody, ORAT1 antibody, TMEM142A antibody, RGD1311873 antibody, D730049H07Rik antibody, Tmem142a antibody, orai-1 antibody, im:7146264 antibody, orai1 antibody, tmem142a antibody, zgc:109721 antibody, orai2 antibody, ORAI1 antibody, LOC100218031 antibody, ORAI calcium release-activated calcium modulator 1 antibody, ORAI calcium release-activated calcium modulator 1b antibody, ORAI calcium release-activated calcium modulator 1 S homeolog antibody, ORAI1 antibody, Orai1 antibody, orai1b antibody, orai1.S antibody, orai1 antibody

Background: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: TCR Signaling, BCR Signaling