ORAI1 antibody (Middle Region)
-
- Target See all ORAI1 Antibodies
- ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ORAI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ORAI1 antibody was raised against the middle region of ORAI1
- Purification
- Affinity purified
- Immunogen
- ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP
- Top Product
- Discover our top product ORAI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ORAI1 Blocking Peptide, catalog no. 33R-3979, is also available for use as a blocking control in assays to test for specificity of this ORAI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))
- Alternative Name
- ORAI1 (ORAI1 Products)
- Synonyms
- CRACM1 antibody, ORAT1 antibody, TMEM142A antibody, RGD1311873 antibody, D730049H07Rik antibody, Tmem142a antibody, orai-1 antibody, im:7146264 antibody, orai1 antibody, tmem142a antibody, zgc:109721 antibody, orai2 antibody, ORAI1 antibody, LOC100218031 antibody, ORAI calcium release-activated calcium modulator 1 antibody, ORAI calcium release-activated calcium modulator 1b antibody, ORAI calcium release-activated calcium modulator 1 S homeolog antibody, ORAI1 antibody, Orai1 antibody, orai1b antibody, orai1.S antibody, orai1 antibody
- Background
- ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- TCR Signaling, BCR Signaling
-