ELOVL5 antibody

Catalog No. ABIN635023

Product Details anti-ELOVL5 Antibody

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELOVL5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELOVL5 Blocking Peptide, catalog no. 33R-2451, is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELOVL5

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Alternative Name: ELOVL5 (ELOVL5 Products)

Synonyms: zgc:63549 antibody, elovl2 antibody, 1110059L23Rik antibody, AI747313 antibody, AU043003 antibody, HELO1 antibody, dJ483K16.1 antibody, rELO1 antibody, ELOVL fatty acid elongase 5 antibody, ELOVL family member 5, elongation of long chain fatty acids (yeast) antibody, ELOVL fatty acid elongase 5 S homeolog antibody, elovl5 antibody, ELOVL5 antibody, Elovl5 antibody, elovl5.S antibody

Background: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

Molecular Weight: 35 kDa (MW of target protein)