SLC25A31 antibody
-
- Target See all SLC25A31 Antibodies
- SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A31 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP
- Top Product
- Discover our top product SLC25A31 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A31 Blocking Peptide, catalog no. 33R-4767, is also available for use as a blocking control in assays to test for specificity of this SLC25A31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))
- Alternative Name
- SLC25A31 (SLC25A31 Products)
- Synonyms
- AAC4 antibody, ANT4 antibody, SFEC35kDa antibody, 1700034J06Rik antibody, Ant4 antibody, Sfec antibody, solute carrier family 25 member 31 antibody, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 antibody, SLC25A31 antibody, Slc25a31 antibody
- Background
- Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase against ADP produced in cytosol by most energy-consuming reactions.
- Molecular Weight
- 35 kDa (MW of target protein)
-