CPT1A antibody

Catalog No. ABIN635089

Product Details anti-CPT1A Antibody

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPT1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPT1A

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Alternative Name: CPT1A (CPT1A Products)

Synonyms: MGC53498 antibody, CPT1 antibody, CPT1-L antibody, L-CPT1 antibody, L-CPTI antibody, si:dkey-56p7.8 antibody, C730027G07 antibody, CPTI antibody, Cpt1 antibody, CPT-Ia antibody, carnitine palmitoyltransferase 1A (liver) L homeolog antibody, carnitine palmitoyltransferase 1A antibody, carnitine palmitoyltransferase 1A (liver) antibody, carnitine palmitoyltransferase 1Aa (liver) antibody, carnitine palmitoyltransferase 1a, liver antibody, cpt1a.L antibody, CPT1A antibody, cpt1a antibody, cpt1aa antibody, Cpt1a antibody

Background: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: AMPK Signaling, Regulation of Lipid Metabolism by PPARalpha, Feeding Behaviour, Monocarboxylic Acid Catabolic Process