MFRP antibody (N-Term)
-
- Target See all MFRP Antibodies
- MFRP (Membrane Frizzled-Related Protein (MFRP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MFRP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MFRP antibody was raised against the N terminal of MFRP
- Purification
- Affinity purified
- Immunogen
- MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
- Top Product
- Discover our top product MFRP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MFRP Blocking Peptide, catalog no. 33R-8996, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFRP (Membrane Frizzled-Related Protein (MFRP))
- Alternative Name
- MFRP (MFRP Products)
- Synonyms
- MFRP antibody, MCOP5 antibody, NNO2 antibody, RD6 antibody, rd6 antibody, C1q and TNF related 5 antibody, membrane frizzled-related protein antibody, C1QTNF5 antibody, MFRP antibody, Mfrp antibody
- Background
- MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.
- Molecular Weight
- 62 kDa (MW of target protein)
-