PTGER3 antibody

Catalog No. ABIN635100

Product Details anti-PTGER3 Antibody

Target: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGER3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTGER3 Blocking Peptide, catalog no. 33R-8894, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGER3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGER3

Target: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Alternative Name: PTGER3 (PTGER3 Products)

Synonyms: PTGER3 antibody, EP3 antibody, EP3-I antibody, EP3-II antibody, EP3-III antibody, EP3-IV antibody, EP3e antibody, PGE2-R antibody, PTGEREP3 antibody, Rep3 antibody, rEP3a antibody, rEP3b antibody, Pgerep3 antibody, Ptgerep3 antibody, prostaglandin E receptor 3 antibody, prostaglandin E receptor 3 L homeolog antibody, prostaglandin E receptor 3 (subtype EP3) antibody, PTGER3 antibody, ptger3.L antibody, Ptger3 antibody

Background: PTGER3 is the receptor for prostaglandin E2 (PGE2), the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.

Molecular Weight: 47 kDa (MW of target protein)