PTGER3 antibody
-
- Target See all PTGER3 Antibodies
- PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGER3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL
- Top Product
- Discover our top product PTGER3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTGER3 Blocking Peptide, catalog no. 33R-8894, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGER3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))
- Alternative Name
- PTGER3 (PTGER3 Products)
- Synonyms
- PTGER3 antibody, EP3 antibody, EP3-I antibody, EP3-II antibody, EP3-III antibody, EP3-IV antibody, EP3e antibody, PGE2-R antibody, PTGEREP3 antibody, Rep3 antibody, rEP3a antibody, rEP3b antibody, Pgerep3 antibody, Ptgerep3 antibody, prostaglandin E receptor 3 antibody, prostaglandin E receptor 3 L homeolog antibody, prostaglandin E receptor 3 (subtype EP3) antibody, PTGER3 antibody, ptger3.L antibody, Ptger3 antibody
- Background
- PTGER3 is the receptor for prostaglandin E2 (PGE2), the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
- Molecular Weight
- 47 kDa (MW of target protein)
-