LRRC8B antibody (Middle Region)
-
- Target See all LRRC8B Antibodies
- LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC8B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC8 B antibody was raised against the middle region of LRRC8
- Purification
- Affinity purified
- Immunogen
- LRRC8 B antibody was raised using the middle region of LRRC8 corresponding to a region with amino acids TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE
- Top Product
- Discover our top product LRRC8B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC8B Blocking Peptide, catalog no. 33R-9195, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))
- Alternative Name
- LRRC8B (LRRC8B Products)
- Synonyms
- TA-LRRP antibody, TALRRP antibody, R75581 antibody, Ta-lrrp antibody, mKIAA0231 antibody, RGD1563429 antibody, leucine rich repeat containing 8 family member B antibody, leucine rich repeat containing 8 VRAC subunit B S homeolog antibody, leucine rich repeat containing 8 VRAC subunit B antibody, leucine rich repeat containing 8 family, member B antibody, LRRC8B antibody, lrrc8b.S antibody, lrrc8b antibody, Lrrc8b antibody
- Background
- The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 92 kDa (MW of target protein)
-