TMEM206 antibody (N-Term)

Catalog No. ABIN635147

Product Details anti-TMEM206 Antibody

Target: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM206 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF75 antibody was raised against the N terminal Of C1 rf75

Purification: Affinity purified

Immunogen: C1 ORF75 antibody was raised using the N terminal Of C1 rf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF75 Blocking Peptide, catalog no. 33R-3958, is also available for use as a blocking control in assays to test for specificity of this C1ORF75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM206

Target: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Alternative Name: C1ORF75 (C1orf75 Products)

Synonyms: C1orf75 antibody, RP11-384C4.5 antibody, 2310028N02Rik antibody, AI118576 antibody, RGD1359339 antibody, C16H1orf75 antibody, transmembrane protein 206 antibody, transmembrane protein 206 L homeolog antibody, TMEM206 antibody, Tmem206 antibody, tmem206.L antibody

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 40 kDa (MW of target protein)