TMEM144 antibody (Middle Region)

Catalog No. ABIN635148

Product Details anti-TMEM144 Antibody

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM144 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM144 antibody was raised against the middle region of TMEM144

Purification: Affinity purified

Immunogen: TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM144 Blocking Peptide, catalog no. 33R-5463, is also available for use as a blocking control in assays to test for specificity of this TMEM144 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM144 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM144

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Alternative Name: TMEM144 (TMEM144 Products)

Synonyms: tmem144 antibody, zgc:100814 antibody, 1110057I03Rik antibody, 5730537D05Rik antibody, RGD1565845 antibody, transmembrane protein 144 antibody, transmembrane protein 144a antibody, transmembrane protein 144 L homeolog antibody, TMEM144 antibody, tmem144a antibody, tmem144 antibody, tmem144.L antibody, Tmem144 antibody

Background: The function of the TMEM144 protein remains unknown.

Molecular Weight: 38 kDa (MW of target protein)